AKR1C2 purified MaxPab mouse polyclonal antibody (B02P) View larger

AKR1C2 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKR1C2 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about AKR1C2 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00001646-B02P
Product name: AKR1C2 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human AKR1C2 protein.
Gene id: 1646
Gene name: AKR1C2
Gene alias: AKR1C-pseudo|BABP|DD|DD2|DDH2|HAKRD|HBAB|MCDR2
Gene description: aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III)
Genbank accession: BC007024.1
Immunogen: AKR1C2 (AAH07024.1, 1 a.a. ~ 323 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Protein accession: AAH07024.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001646-B02P-2-A1-1.jpg
Application image note: AKR1C2 MaxPab polyclonal antibody. Western Blot analysis of AKR1C2 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice
Publications: Proteasome inhibitors MG-132 and bortezomib induce AKR1C1; AKR1C3; AKR1B1; and AKR1B10 in human colon cancer cell lines SW-480 and HT-29.Ebert B, Kisiela M, Wsol V, Maser E.
Chem Biol Interact. 2011 Jan 6. [Epub ahead of print]

Reviews

Buy AKR1C2 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart