Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AKR1C2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
More info about AKR1C2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001646-A01 |
| Product name: | AKR1C2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant AKR1C2. |
| Gene id: | 1646 |
| Gene name: | AKR1C2 |
| Gene alias: | AKR1C-pseudo|BABP|DD|DD2|DDH2|HAKRD|HBAB|MCDR2 |
| Gene description: | aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) |
| Genbank accession: | BC063574 |
| Immunogen: | AKR1C2 (AAH63574, 224 a.a. ~ 323 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPVSDEY |
| Protein accession: | AAH63574 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AKR1C2 polyclonal antibody (A01), Lot # CIL0060112QCS1 Western Blot analysis of AKR1C2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Aldo-keto reductase 1C2 is essential for 1-nitropyrene's but not for benzo[a]pyrene's induction of p53 phosphorylation and apoptosis.Su JG, Liao PJ, Huang MC, Chu WC, Lin SC, Chang YJ. Toxicology. 2008 Feb 28;244(2-3):257-70. Epub 2007 Dec 7. |