Brand: | Abnova |
Reference: | H00001645-M01 |
Product name: | AKR1C1 monoclonal antibody (M01), clone 1B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKR1C1. |
Clone: | 1B3 |
Isotype: | IgG2a Kappa |
Gene id: | 1645 |
Gene name: | AKR1C1 |
Gene alias: | 2-ALPHA-HSD|20-ALPHA-HSD|C9|DD1|DDH|DDH1|H-37|HAKRC|MBAB|MGC8954 |
Gene description: | aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) |
Genbank accession: | BC020216 |
Immunogen: | AKR1C1 (AAH20216, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDY |
Protein accession: | AAH20216 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | AKR1C1 monoclonal antibody (M01), clone 1B3. Western Blot analysis of AKR1C1 expression in HeLa. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |