Brand: | Abnova |
Reference: | H00001645-D01 |
Product name: | AKR1C1 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human AKR1C1 protein. |
Gene id: | 1645 |
Gene name: | AKR1C1 |
Gene alias: | 2-ALPHA-HSD|20-ALPHA-HSD|C9|DD1|DDH|DDH1|H-37|HAKRC|MBAB|MGC8954 |
Gene description: | aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) |
Genbank accession: | NM_001353.5 |
Immunogen: | AKR1C1 (NP_001344.2, 1 a.a. ~ 323 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
Protein accession: | NP_001344.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00001645-D01-2-A1-1.jpg](http://www.abnova.com/application_image/H00001645-D01-2-A1-1.jpg) |
Application image note: | AKR1C1 MaxPab rabbit polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |