Brand: | Abnova |
Reference: | H00001645-A01 |
Product name: | AKR1C1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant AKR1C1. |
Gene id: | 1645 |
Gene name: | AKR1C1 |
Gene alias: | 2-ALPHA-HSD|20-ALPHA-HSD|C9|DD1|DDH|DDH1|H-37|HAKRC|MBAB|MGC8954 |
Gene description: | aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) |
Genbank accession: | BC020216 |
Immunogen: | AKR1C1 (AAH20216, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDY |
Protein accession: | AAH20216 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00001645-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00001645-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00001645-A01-1-1-1.jpg](http://www.abnova.com/application_image/H00001645-A01-1-1-1.jpg) |
Application image note: | AKR1C1 polyclonal antibody (A01), Lot # 070510JCS1 Western Blot analysis of AKR1C1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Molecular effectors and modulators of hypericin-mediated cell death in bladder cancer cells.Buytaert E, Matroule JY, Durinck S, Close P, Kocanova S, Vandenheede JR, de Witte PA, Piette J, Agostinis P. Oncogene. 2008 Mar 20;27(13):1916-29. Epub 2007 Oct 22. |