Brand: | Abnova |
Reference: | H00001643-M01 |
Product name: | DDB2 monoclonal antibody (M01), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DDB2. |
Clone: | 1F11 |
Isotype: | IgG2b Kappa |
Gene id: | 1643 |
Gene name: | DDB2 |
Gene alias: | DDBB|FLJ34321|UV-DDB2 |
Gene description: | damage-specific DNA binding protein 2, 48kDa |
Genbank accession: | BC000093 |
Immunogen: | DDB2 (AAH00093, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAP |
Protein accession: | AAH00093 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |