Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACE monoclonal antibody (M01), clone 6A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about ACE monoclonal antibody (M01), clone 6A4
| Brand: | Abnova |
| Reference: | H00001636-M01 |
| Product name: | ACE monoclonal antibody (M01), clone 6A4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACE. |
| Clone: | 6A4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1636 |
| Gene name: | ACE |
| Gene alias: | ACE1|CD143|DCP|DCP1|MGC26566 |
| Gene description: | angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 |
| Genbank accession: | BC036375 |
| Immunogen: | ACE (AAH36375, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYM |
| Protein accession: | AAH36375 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ACE is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Phosphorylation of the Eukaryotic Translation Initiation Factor 4E-Transporter (4E-T) by c-Jun N-Terminal Kinase Promotes Stress-Dependent P-Body Assembly.Cargnello M, Tcherkezian J, Dorn JF, Huttlin EL, Maddox PS, Gygi SP, Roux PP. Mol Cell Biol. 2012 Nov;32(22):4572-84. doi: 10.1128/MCB.00544-12. Epub 2012 Sep 10. |