Brand: | Abnova |
Reference: | H00001633-M01 |
Product name: | DCK monoclonal antibody (M01), clone 1E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DCK. |
Clone: | 1E7 |
Isotype: | IgG2a Kappa |
Gene id: | 1633 |
Gene name: | DCK |
Gene alias: | MGC117410|MGC138632 |
Gene description: | deoxycytidine kinase |
Genbank accession: | NM_000788 |
Immunogen: | DCK (NP_000779, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL |
Protein accession: | NP_000779 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DCK is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |