DCI polyclonal antibody (A01) View larger

DCI polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCI polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about DCI polyclonal antibody (A01)

Brand: Abnova
Reference: H00001632-A01
Product name: DCI polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DCI.
Gene id: 1632
Gene name: DCI
Gene alias: -
Gene description: dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase)
Genbank accession: NM_001919
Immunogen: DCI (NP_001910, 204 a.a. ~ 302 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQMYLERLKEEKG
Protein accession: NP_001910
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001632-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001632-A01-1-1-1.jpg
Application image note: DCI polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of DCI expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DCI polyclonal antibody (A01) now

Add to cart