DBP monoclonal antibody (M01), clone 3A6 View larger

DBP monoclonal antibody (M01), clone 3A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DBP monoclonal antibody (M01), clone 3A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DBP monoclonal antibody (M01), clone 3A6

Brand: Abnova
Reference: H00001628-M01
Product name: DBP monoclonal antibody (M01), clone 3A6
Product description: Mouse monoclonal antibody raised against a partial recombinant DBP.
Clone: 3A6
Isotype: IgG1 Kappa
Gene id: 1628
Gene name: DBP
Gene alias: DABP
Gene description: D site of albumin promoter (albumin D-box) binding protein
Genbank accession: NM_001352
Immunogen: DBP (NP_001343, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Protein accession: NP_001343
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001628-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001628-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DBP is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DBP monoclonal antibody (M01), clone 3A6 now

Add to cart