Brand: | Abnova |
Reference: | H00001617-M01 |
Product name: | DAZ1 monoclonal antibody (M01), clone 3G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DAZ1. |
Clone: | 3G10 |
Isotype: | IgG1 Kappa |
Gene id: | 1617 |
Gene name: | DAZ1 |
Gene alias: | DAZ|SPGY |
Gene description: | deleted in azoospermia 1 |
Genbank accession: | NG_004755 |
Immunogen: | DAZ1 (AAH18119, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC |
Protein accession: | AAH18119 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DAZ1 monoclonal antibody (M01), clone 3G10. Western Blot analysis of DAZ1 expression in human pancreas. |
Applications: | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |