Brand: | Abnova |
Reference: | H00001604-M02 |
Product name: | DAF monoclonal antibody (M02), clone 1D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DAF. |
Clone: | 1D7 |
Isotype: | IgG1 Kappa |
Gene id: | 1604 |
Gene name: | CD55 |
Gene alias: | CR|CROM|DAF|TC |
Gene description: | CD55 molecule, decay accelerating factor for complement (Cromer blood group) |
Genbank accession: | NM_000574 |
Immunogen: | DAF (NP_000565, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLRGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYR |
Protein accession: | NP_000565 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CD55 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |