Brand: | Abnova |
Reference: | H00001603-M03A |
Product name: | DAD1 monoclonal antibody (M03A), clone S1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant DAD1. |
Clone: | S1 |
Isotype: | IgG2b Kappa |
Gene id: | 1603 |
Gene name: | DAD1 |
Gene alias: | OST2 |
Gene description: | defender against cell death 1 |
Genbank accession: | BC007403 |
Immunogen: | DAD1 (AAH07403, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG |
Protein accession: | AAH07403 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |