Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CYP24A1 monoclonal antibody (M02), clone 1E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CYP24A1 monoclonal antibody (M02), clone 1E1
| Brand: | Abnova |
| Reference: | H00001591-M02 |
| Product name: | CYP24A1 monoclonal antibody (M02), clone 1E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP24A1. |
| Clone: | 1E1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1591 |
| Gene name: | CYP24A1 |
| Gene alias: | CP24|CYP24|MGC126273|MGC126274|P450-CC24 |
| Gene description: | cytochrome P450, family 24, subfamily A, polypeptide 1 |
| Genbank accession: | NM_000782 |
| Immunogen: | CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR |
| Protein accession: | NP_000773 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CYP24A1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Dysregulation of renal vitamin D metabolism in the uremic rat.Helvig CF, Cuerrier D, Hosfield CM, Ireland B, Kharebov AZ, Kim JW, Ramjit NJ, Ryder K, Tabash SP, Herzenberg AM, Epps TM, Petkovich M. Kidney Int. 2010 Jun 9. [Epub ahead of print] |