Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00001584-D01P |
Product name: | CYP11B1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CYP11B1 protein. |
Gene id: | 1584 |
Gene name: | CYP11B1 |
Gene alias: | CPN1|CYP11B|DKFZp686B05283|FHI|FLJ36771|P450C11 |
Gene description: | cytochrome P450, family 11, subfamily B, polypeptide 1 |
Genbank accession: | BC096285.3 |
Immunogen: | CYP11B1 (AAH96285.1, 1 a.a. ~ 574 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLWRCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHSGCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN |
Protein accession: | AAH96285.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CYP11B1 expression in transfected 293T cell line (H00001584-T02) by CYP11B1 MaxPab polyclonal antibody. Lane 1: CYP11B1 transfected lysate(65.10 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |