CYP11B1 MaxPab mouse polyclonal antibody (B01) View larger

CYP11B1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYP11B1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CYP11B1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00001584-B01
Product name: CYP11B1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CYP11B1 protein.
Gene id: 1584
Gene name: CYP11B1
Gene alias: CPN1|CYP11B|DKFZp686B05283|FHI|FLJ36771|P450C11
Gene description: cytochrome P450, family 11, subfamily B, polypeptide 1
Genbank accession: BC096285.3
Immunogen: CYP11B1 (AAH96285.1, 1 a.a. ~ 574 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLWRCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHSGCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
Protein accession: AAH96285.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001584-B01-13-15-1.jpg
Application image note: Western Blot analysis of CYP11B1 expression in transfected 293T cell line (H00001584-T01) by CYP11B1 MaxPab polyclonal antibody.

Lane 1: CYP11B1 transfected lysate(63.14 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CYP11B1 MaxPab mouse polyclonal antibody (B01) now

Add to cart