CYP2J2 polyclonal antibody (A01) View larger

CYP2J2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYP2J2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CYP2J2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001573-A01
Product name: CYP2J2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CYP2J2.
Gene id: 1573
Gene name: CYP2J2
Gene alias: CPJ2
Gene description: cytochrome P450, family 2, subfamily J, polypeptide 2
Genbank accession: NM_000775
Immunogen: CYP2J2 (NP_000766, 408 a.a. ~ 498 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Protein accession: NP_000766
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001573-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CYP2J2 polyclonal antibody (A01) now

Add to cart