CYP2E1 purified MaxPab mouse polyclonal antibody (B01P) View larger

CYP2E1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYP2E1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P,IF,WB-Tr

More info about CYP2E1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001571-B01P
Product name: CYP2E1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CYP2E1 protein.
Gene id: 1571
Gene name: CYP2E1
Gene alias: CPE1|CYP2E|P450-J|P450C2E
Gene description: cytochrome P450, family 2, subfamily E, polypeptide 1
Genbank accession: NM_000773.3
Immunogen: CYP2E1 (NP_000764.1, 1 a.a. ~ 493 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
Protein accession: NP_000764.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001571-B01P-2-A1-1.jpg
Application image note: CYP2E1 MaxPab polyclonal antibody. Western Blot analysis of CYP2E1 expression in human liver.
Applications: WB-Ti,IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CYP2E1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart