H00001548-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001548-M01 |
Product name: | CYP2A6 monoclonal antibody (M01), clone 3B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP2A6. |
Clone: | 3B11 |
Isotype: | IgG2a Kappa |
Gene id: | 1548 |
Gene name: | CYP2A6 |
Gene alias: | CPA6|CYP2A|CYP2A3|P450C2A|P450PB |
Gene description: | cytochrome P450, family 2, subfamily A, polypeptide 6 |
Genbank accession: | NG_000008 |
Immunogen: | CYP2A6 (AAH28215, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR |
Protein accession: | AAH28215 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged CYP2A6 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |