CYP2A6 monoclonal antibody (M01), clone 3B11 View larger

CYP2A6 monoclonal antibody (M01), clone 3B11

H00001548-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYP2A6 monoclonal antibody (M01), clone 3B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CYP2A6 monoclonal antibody (M01), clone 3B11

Brand: Abnova
Reference: H00001548-M01
Product name: CYP2A6 monoclonal antibody (M01), clone 3B11
Product description: Mouse monoclonal antibody raised against a partial recombinant CYP2A6.
Clone: 3B11
Isotype: IgG2a Kappa
Gene id: 1548
Gene name: CYP2A6
Gene alias: CPA6|CYP2A|CYP2A3|P450C2A|P450PB
Gene description: cytochrome P450, family 2, subfamily A, polypeptide 6
Genbank accession: NG_000008
Immunogen: CYP2A6 (AAH28215, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR
Protein accession: AAH28215
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001548-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001548-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged CYP2A6 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CYP2A6 monoclonal antibody (M01), clone 3B11 now

Add to cart