H00001545-M03_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00001545-M03 |
Product name: | CYP1B1 monoclonal antibody (M03), clone 2F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP1B1. |
Clone: | 2F8 |
Isotype: | IgG2b Kappa |
Gene id: | 1545 |
Gene name: | CYP1B1 |
Gene alias: | CP1B|GLC3A|P4501B1 |
Gene description: | cytochrome P450, family 1, subfamily B, polypeptide 1 |
Genbank accession: | NM_000104 |
Immunogen: | CYP1B1 (NP_000095, 453 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC |
Protein accession: | NP_000095 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged CYP1B1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |