CYP1A2 monoclonal antibody (M07), clone 2D7 View larger

CYP1A2 monoclonal antibody (M07), clone 2D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYP1A2 monoclonal antibody (M07), clone 2D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CYP1A2 monoclonal antibody (M07), clone 2D7

Brand: Abnova
Reference: H00001544-M07
Product name: CYP1A2 monoclonal antibody (M07), clone 2D7
Product description: Mouse monoclonal antibody raised against a partial recombinant CYP1A2.
Clone: 2D7
Isotype: IgG3 Kappa
Gene id: 1544
Gene name: CYP1A2
Gene alias: CP12|P3-450|P450(PA)
Gene description: cytochrome P450, family 1, subfamily A, polypeptide 2
Genbank accession: NM_000761
Immunogen: CYP1A2 (NP_000752, 211 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL
Protein accession: NP_000752
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001544-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001544-M07-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CYP1A2 is 0.03 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CYP1A2 monoclonal antibody (M07), clone 2D7 now

Add to cart