Brand: | Abnova |
Reference: | H00001540-M03 |
Product name: | CYLD monoclonal antibody (M03), clone 2G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CYLD. |
Clone: | 2G1 |
Isotype: | IgG2a Kappa |
Gene id: | 1540 |
Gene name: | CYLD |
Gene alias: | CDMT|CYLD1|CYLDI|EAC|FLJ20180|FLJ31664|FLJ78684|HSPC057|KIAA0849|MFT|MFT1|SBS|TEM|USPL2 |
Gene description: | cylindromatosis (turban tumor syndrome) |
Genbank accession: | BC012342 |
Immunogen: | CYLD (AAH12342, 854 a.a. ~ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK |
Protein accession: | AAH12342 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |