CYB5A monoclonal antibody (M06A), clone 1A8 View larger

CYB5A monoclonal antibody (M06A), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYB5A monoclonal antibody (M06A), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about CYB5A monoclonal antibody (M06A), clone 1A8

Brand: Abnova
Reference: H00001528-M06A
Product name: CYB5A monoclonal antibody (M06A), clone 1A8
Product description: Mouse monoclonal antibody raised against a full-length recombinant CYB5A.
Clone: 1A8
Isotype: IgG1 Kappa
Gene id: 1528
Gene name: CYB5A
Gene alias: CYB5|MCB5
Gene description: cytochrome b5 type A (microsomal)
Genbank accession: BC015182
Immunogen: CYB5A (AAH15182, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED
Protein accession: AAH15182
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001528-M06A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001528-M06A-13-15-1.jpg
Application image note: Western Blot analysis of CYB5A expression in transfected 293T cell line by CYB5A monoclonal antibody (M06A), clone 1A8.

Lane 1: CYB5A transfected lysate(15.3 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CYB5A monoclonal antibody (M06A), clone 1A8 now

Add to cart