Brand: | Abnova |
Reference: | H00001528-M06 |
Product name: | CYB5A monoclonal antibody (M06), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CYB5A. |
Clone: | 1A8 |
Isotype: | IgG1 Kappa |
Gene id: | 1528 |
Gene name: | CYB5A |
Gene alias: | CYB5|MCB5 |
Gene description: | cytochrome b5 type A (microsomal) |
Genbank accession: | BC015182 |
Immunogen: | CYB5A (AAH15182, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED |
Protein accession: | AAH15182 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.48 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CYB5A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo.Ming DS, Pham S, Deb S, Chin MY, Kharmate G, Adomat H, Beheshti EH, Locke J, Guns ET J Steroid Biochem Mol Biol. 2014 Feb 22;143C:19-28. doi: 10.1016/j.jsbmb.2014.02.006. |