Brand: | Abnova |
Reference: | H00001528-M05 |
Product name: | CYB5A monoclonal antibody (M05), clone 4C2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CYB5A. |
Clone: | 4C2 |
Isotype: | IgG1 Kappa |
Gene id: | 1528 |
Gene name: | CYB5A |
Gene alias: | CYB5|MCB5 |
Gene description: | cytochrome b5 type A (microsomal) |
Genbank accession: | BC015182 |
Immunogen: | CYB5A (AAH15182, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED |
Protein accession: | AAH15182 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.48 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CYB5A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |