CTSS MaxPab rabbit polyclonal antibody (D01) View larger

CTSS MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTSS MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about CTSS MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00001520-D01
Product name: CTSS MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CTSS protein.
Gene id: 1520
Gene name: CTSS
Gene alias: MGC3886
Gene description: cathepsin S
Genbank accession: NM_004079
Immunogen: CTSS (NP_004070.3, 1 a.a. ~ 331 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Protein accession: NP_004070.3
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001520-D01-31-15-1.jpg
Application image note: Immunoprecipitation of CTSS transfected lysate using anti-CTSS MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CTSS purified MaxPab mouse polyclonal antibody (B02P) (H00001520-B02P).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CTSS MaxPab rabbit polyclonal antibody (D01) now

Add to cart