CTSE MaxPab mouse polyclonal antibody (B01) View larger

CTSE MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTSE MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about CTSE MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00001510-B01
Product name: CTSE MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CTSE protein.
Gene id: 1510
Gene name: CTSE
Gene alias: CATE
Gene description: cathepsin E
Genbank accession: BC042537
Immunogen: CTSE (AAH42537, 18 a.a. ~ 396 a.a) full-length human protein.
Immunogen sequence/protein sequence: QGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTLVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP
Protein accession: AAH42537
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001510-B01-13-15-1.jpg
Application image note: Western Blot analysis of CTSE expression in transfected 293T cell line (H00001510-T01) by CTSE MaxPab polyclonal antibody.

Lane 1: CTSE transfected lysate(43.67 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CTSE MaxPab mouse polyclonal antibody (B01) now

Add to cart