CTNS polyclonal antibody (A01) View larger

CTNS polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTNS polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CTNS polyclonal antibody (A01)

Brand: Abnova
Reference: H00001497-A01
Product name: CTNS polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CTNS.
Gene id: 1497
Gene name: CTNS
Gene alias: CTNS-LSB|PQLC4
Gene description: cystinosis, nephropathic
Genbank accession: NM_004937
Immunogen: CTNS (NP_004928, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY
Protein accession: NP_004928
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001497-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001497-A01-1-1-1.jpg
Application image note: CTNS polyclonal antibody (A01), Lot # 060623JCS1 Western Blot analysis of CTNS expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CTNS polyclonal antibody (A01) now

Add to cart