Brand: | Abnova |
Reference: | H00001489-D01P |
Product name: | CTF1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CTF1 protein. |
Gene id: | 1489 |
Gene name: | CTF1 |
Gene alias: | CT-1|CT1 |
Gene description: | cardiotrophin 1 |
Genbank accession: | NM_001330 |
Immunogen: | CTF1 (NP_001321.1, 1 a.a. ~ 201 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Protein accession: | NP_001321.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CTF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CTF1 expression in Jurkat. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |