CSTB MaxPab mouse polyclonal antibody (B02) View larger

CSTB MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSTB MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about CSTB MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00001476-B02
Product name: CSTB MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human CSTB protein.
Gene id: 1476
Gene name: CSTB
Gene alias: CST6|EPM1|PME|STFB
Gene description: cystatin B (stefin B)
Genbank accession: NM_000100.2
Immunogen: CSTB (NP_000091.1, 1 a.a. ~ 98 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Protein accession: NP_000091.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001476-B02-13-15-1.jpg
Application image note: Western Blot analysis of CSTB expression in transfected 293T cell line (H00001476-T02) by CSTB MaxPab polyclonal antibody.

Lane 1: CSTB transfected lysate(10.78 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSTB MaxPab mouse polyclonal antibody (B02) now

Add to cart