CSTB MaxPab mouse polyclonal antibody (B01) View larger

CSTB MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSTB MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CSTB MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00001476-B01
Product name: CSTB MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CSTB protein.
Gene id: 1476
Gene name: CSTB
Gene alias: CST6|EPM1|PME|STFB
Gene description: cystatin B (stefin B)
Genbank accession: BC003370
Immunogen: CSTB (AAH03370.1, 1 a.a. ~ 98 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Protein accession: AAH03370
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001476-B01-13-15-1.jpg
Application image note: Western Blot analysis of CSTB expression in transfected 293T cell line (H00001476-T01) by CSTB MaxPab polyclonal antibody.

Lane1:CSTB transfected lysate(10.89 KDa).
Lane 2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSTB MaxPab mouse polyclonal antibody (B01) now

Add to cart