CSNK2B purified MaxPab mouse polyclonal antibody (B01P) View larger

CSNK2B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSNK2B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CSNK2B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001460-B01P
Product name: CSNK2B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CSNK2B protein.
Gene id: 1460
Gene name: CSNK2B
Gene alias: CK2B|CK2N|CSK2B|G5A|MGC138222|MGC138224
Gene description: casein kinase 2, beta polypeptide
Genbank accession: NM_001320
Immunogen: CSNK2B (NP_001311.3, 1 a.a. ~ 215 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Protein accession: NP_001311.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001460-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CSNK2B expression in transfected 293T cell line (H00001460-T02) by CSNK2B MaxPab polyclonal antibody.

Lane 1: CSNK2B transfected lysate(23.65 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSNK2B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart