CSH2 purified MaxPab mouse polyclonal antibody (B02P) View larger

CSH2 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSH2 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about CSH2 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00001443-B02P
Product name: CSH2 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human CSH2 protein.
Gene id: 1443
Gene name: CSH2
Gene alias: CS-2|CSB|hCS-B
Gene description: chorionic somatomammotropin hormone 2
Genbank accession: NM_020991.3
Immunogen: CSH2 (NP_066271.1, 1 a.a. ~ 217 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Protein accession: NP_066271.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001443-B02P-13-15-1.jpg
Application image note: Western Blot analysis of CSH2 expression in transfected 293T cell line (H00001443-T02) by CSH2 MaxPab polyclonal antibody.

Lane 1: CSH2 transfected lysate(23.87 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSH2 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart