Brand: | Abnova |
Reference: | H00001440-M03 |
Product name: | CSF3 monoclonal antibody (M03), clone 2C5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CSF3. |
Clone: | 2C5 |
Isotype: | IgG2a Kappa |
Gene id: | 1440 |
Gene name: | CSF3 |
Gene alias: | G-CSF|GCSF|MGC45931 |
Gene description: | colony stimulating factor 3 (granulocyte) |
Genbank accession: | N/A |
Immunogen: | CSF3 (NP_757373, 31 a.a. ~ 207 a.a) recombinant protein. |
Immunogen sequence/protein sequence: | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Protein accession: | - |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of CSF3 transfected lysate using anti-CSF3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CSF3 MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,IP |
Shipping condition: | Dry Ice |