CSF3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

CSF3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSF3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about CSF3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00001440-D01P
Product name: CSF3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CSF3 protein.
Gene id: 1440
Gene name: CSF3
Gene alias: G-CSF|GCSF|MGC45931
Gene description: colony stimulating factor 3 (granulocyte)
Genbank accession: NM_000759
Immunogen: CSF3 (NP_000750.1, 1 a.a. ~ 207 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Protein accession: NP_000750.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001440-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CSF3 expression in transfected 293T cell line (H00001440-T01) by CSF3 MaxPab polyclonal antibody.

Lane 1: CSF3 transfected lysate(22.30 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSF3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart