Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CSF3 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IF,WB-Tr,IP |
More info about CSF3 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00001440-D01 |
| Product name: | CSF3 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CSF3 protein. |
| Gene id: | 1440 |
| Gene name: | CSF3 |
| Gene alias: | G-CSF|GCSF|MGC45931 |
| Gene description: | colony stimulating factor 3 (granulocyte) |
| Genbank accession: | NM_000759 |
| Immunogen: | CSF3 (NP_000750.1, 1 a.a. ~ 207 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Protein accession: | NP_000750.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CSF3 expression in transfected 293T cell line (H00001440-T01) by CSF3 MaxPab polyclonal antibody. Lane 1: CSF3 transfected lysate(22.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr,IP |
| Shipping condition: | Dry Ice |