Brand: | Abnova |
Reference: | H00001436-M02 |
Product name: | CSF1R monoclonal antibody (M02), clone 3G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CSF1R. |
Clone: | 3G12 |
Isotype: | IgG1 Kappa |
Gene id: | 1436 |
Gene name: | CSF1R |
Gene alias: | C-FMS|CD115|CSFR|FIM2|FMS |
Gene description: | colony stimulating factor 1 receptor |
Genbank accession: | BC047521 |
Immunogen: | CSF1R (AAH47521, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED |
Protein accession: | AAH47521 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CSF1R monoclonal antibody (M02), clone 3G12 Western Blot analysis of CSF1R expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |