Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001435-M01 |
Product name: | CSF1 monoclonal antibody (M01), clone 1A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CSF1. |
Clone: | 1A9 |
Isotype: | IgG1 Kappa |
Gene id: | 1435 |
Gene name: | CSF1 |
Gene alias: | MCSF|MGC31930 |
Gene description: | colony stimulating factor 1 (macrophage) |
Genbank accession: | BC021117 |
Immunogen: | CSF1 (AAH21117, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK |
Protein accession: | AAH21117 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CSF1 expression in transfected 293T cell line by CSF1 monoclonal antibody (M01), clone 1A9. Lane 1: CSF1 transfected lysate(60.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.Zhu XL, Zeng YF, Guan J, Li YF, Deng YJ, Bian XW, Ding YQ, Liang L. J Pathol. 2011 Jul;224(3):377-88. doi: 10.1002/path.2871. Epub 2011 Apr 19. |