Brand: | Abnova |
Reference: | H00001434-M07 |
Product name: | CSE1L monoclonal antibody (M07), clone 1C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CSE1L. |
Clone: | 1C4 |
Isotype: | IgG1 kappa |
Gene id: | 1434 |
Gene name: | CSE1L |
Gene alias: | CAS|CSE1|MGC117283|MGC130036|MGC130037|XPO2 |
Gene description: | CSE1 chromosome segregation 1-like (yeast) |
Genbank accession: | NM_001316 |
Immunogen: | CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL |
Protein accession: | NP_001307 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |