CSE1L monoclonal antibody (M04A), clone 2F4 View larger

CSE1L monoclonal antibody (M04A), clone 2F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSE1L monoclonal antibody (M04A), clone 2F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CSE1L monoclonal antibody (M04A), clone 2F4

Brand: Abnova
Reference: H00001434-M04A
Product name: CSE1L monoclonal antibody (M04A), clone 2F4
Product description: Mouse monoclonal antibody raised against a partial recombinant CSE1L.
Clone: 2F4
Isotype: IgG1 Kappa
Gene id: 1434
Gene name: CSE1L
Gene alias: CAS|CSE1|MGC117283|MGC130036|MGC130037|XPO2
Gene description: CSE1 chromosome segregation 1-like (yeast)
Genbank accession: NM_001316
Immunogen: CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Protein accession: NP_001307
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001434-M04A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001434-M04A-1-25-1.jpg
Application image note: CSE1L monoclonal antibody (M04A), clone 2F4 Western Blot analysis of CSE1L expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CSE1L monoclonal antibody (M04A), clone 2F4 now

Add to cart