Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAPK14 monoclonal antibody (M01), clone 3D5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
More info about MAPK14 monoclonal antibody (M01), clone 3D5
| Brand: | Abnova |
| Reference: | H00001432-M01 |
| Product name: | MAPK14 monoclonal antibody (M01), clone 3D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK14. |
| Clone: | 3D5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1432 |
| Gene name: | MAPK14 |
| Gene alias: | CSBP1|CSBP2|CSPB1|EXIP|Mxi2|PRKM14|PRKM15|RK|SAPK2A|p38|p38ALPHA |
| Gene description: | mitogen-activated protein kinase 14 |
| Genbank accession: | BC031574 |
| Immunogen: | MAPK14 (AAH31574, 260 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| Protein accession: | AAH31574 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MAPK14 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | p38 predicts depression and poor outcome in esophageal cancer.Cheng Y, Qiao Z, Dang C, Zhou B, Li S, Zhang W, Jiang J, Song Y, Zhang J, Diao D. Oncol Lett. 2017 Dec;14(6):7241-7249. doi: 10.3892/ol.2017.7129. Epub 2017 Oct 3. |