Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00001432-D01P |
Product name: | MAPK14 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human MAPK14 protein. |
Gene id: | 1432 |
Gene name: | MAPK14 |
Gene alias: | CSBP1|CSBP2|CSPB1|EXIP|Mxi2|PRKM14|PRKM15|RK|SAPK2A|p38|p38ALPHA |
Gene description: | mitogen-activated protein kinase 14 |
Genbank accession: | NM_139012 |
Immunogen: | MAPK14 (NP_620581.1, 1 a.a. ~ 360 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Protein accession: | NP_620581.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MAPK14 expression in transfected 293T cell line (H00001432-T02) by MAPK14 MaxPab polyclonal antibody. Lane 1: MAPK14 transfected lysate(41.30 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |