MAPK14 purified MaxPab mouse polyclonal antibody (B01P) View larger

MAPK14 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK14 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about MAPK14 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001432-B01P
Product name: MAPK14 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MAPK14 protein.
Gene id: 1432
Gene name: MAPK14
Gene alias: CSBP1|CSBP2|CSPB1|EXIP|Mxi2|PRKM14|PRKM15|RK|SAPK2A|p38|p38ALPHA
Gene description: mitogen-activated protein kinase 14
Genbank accession: NM_139012
Immunogen: MAPK14 (NP_620581.1, 1 a.a. ~ 360 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Protein accession: NP_620581.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001432-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MAPK14 expression in transfected 293T cell line (H00001432-T01) by MAPK14 MaxPab polyclonal antibody.

Lane 1: MAPK14 transfected lysate(39.6 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAPK14 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart