CRYZ MaxPab rabbit polyclonal antibody (D01) View larger

CRYZ MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRYZ MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about CRYZ MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00001429-D01
Product name: CRYZ MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CRYZ protein.
Gene id: 1429
Gene name: CRYZ
Gene alias: DKFZp779E0834|FLJ41475
Gene description: crystallin, zeta (quinone reductase)
Genbank accession: NM_001889.2
Immunogen: CRYZ (NP_001880.2, 1 a.a. ~ 329 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL
Protein accession: NP_001880.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001429-D01-31-15-1.jpg
Application image note: Immunoprecipitation of CRYZ transfected lysate using anti-CRYZ MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CRYZ purified MaxPab mouse polyclonal antibody (B01P) (H00001429-B01P).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CRYZ MaxPab rabbit polyclonal antibody (D01) now

Add to cart