CRYZ purified MaxPab mouse polyclonal antibody (B01P) View larger

CRYZ purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRYZ purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CRYZ purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001429-B01P
Product name: CRYZ purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CRYZ protein.
Gene id: 1429
Gene name: CRYZ
Gene alias: DKFZp779E0834|FLJ41475
Gene description: crystallin, zeta (quinone reductase)
Genbank accession: NM_001889.2
Immunogen: CRYZ (NP_001880.2, 1 a.a. ~ 329 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL
Protein accession: NP_001880.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001429-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CRYZ expression in transfected 293T cell line (H00001429-T01) by CRYZ MaxPab polyclonal antibody.

Lane1:CRYZ transfected lysate(36.19 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CRYZ purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart