CRYZ MaxPab mouse polyclonal antibody (B01) View larger

CRYZ MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRYZ MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CRYZ MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00001429-B01
Product name: CRYZ MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CRYZ protein.
Gene id: 1429
Gene name: CRYZ
Gene alias: DKFZp779E0834|FLJ41475
Gene description: crystallin, zeta (quinone reductase)
Genbank accession: NM_001889.2
Immunogen: CRYZ (NP_001880.2, 1 a.a. ~ 329 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL
Protein accession: NP_001880.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001429-B01-13-15-1.jpg
Application image note: Western Blot analysis of CRYZ expression in transfected 293T cell line (H00001429-T01) by CRYZ MaxPab polyclonal antibody.

Lane1:CRYZ transfected lysate(36.19 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CRYZ MaxPab mouse polyclonal antibody (B01) now

Add to cart