Brand: | Abnova |
Reference: | H00001428-D01 |
Product name: | CRYM MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CRYM protein. |
Gene id: | 1428 |
Gene name: | CRYM |
Gene alias: | DFNA40|THBP |
Gene description: | crystallin, mu |
Genbank accession: | NM_001888.2 |
Immunogen: | CRYM (NP_001879.1, 1 a.a. ~ 314 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK |
Protein accession: | NP_001879.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of CRYM transfected lysate using anti-CRYM MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CRYM purified MaxPab mouse polyclonal antibody (B01P) (H00001428-B01P). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |