CRYBB1 monoclonal antibody (M01), clone 2B2 View larger

CRYBB1 monoclonal antibody (M01), clone 2B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRYBB1 monoclonal antibody (M01), clone 2B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CRYBB1 monoclonal antibody (M01), clone 2B2

Brand: Abnova
Reference: H00001414-M01
Product name: CRYBB1 monoclonal antibody (M01), clone 2B2
Product description: Mouse monoclonal antibody raised against a full length recombinant CRYBB1.
Clone: 2B2
Isotype: IgG1 Kappa
Gene id: 1414
Gene name: CRYBB1
Gene alias: CATCN3
Gene description: crystallin, beta B1
Genbank accession: BC036790
Immunogen: CRYBB1 (AAH36790.1, 1 a.a. ~ 252 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK
Protein accession: AAH36790.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001414-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (53.46 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001414-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CRYBB1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CRYBB1 monoclonal antibody (M01), clone 2B2 now

Add to cart