CRY1 monoclonal antibody (M02), clone 2G4-1F6 View larger

CRY1 monoclonal antibody (M02), clone 2G4-1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRY1 monoclonal antibody (M02), clone 2G4-1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CRY1 monoclonal antibody (M02), clone 2G4-1F6

Brand: Abnova
Reference: H00001407-M02
Product name: CRY1 monoclonal antibody (M02), clone 2G4-1F6
Product description: Mouse monoclonal antibody raised against a full-length recombinant CRY1.
Clone: 2G4-1F6
Isotype: IgG1 Kappa
Gene id: 1407
Gene name: CRY1
Gene alias: PHLL1
Gene description: cryptochrome 1 (photolyase-like)
Genbank accession: BC030519
Immunogen: CRY1 (AAH30519, 1 a.a. ~ 586 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Protein accession: AAH30519
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001407-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (90.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001407-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CRY1 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CRY1 monoclonal antibody (M02), clone 2G4-1F6 now

Add to cart