Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CRX monoclonal antibody (M03), clone 2F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about CRX monoclonal antibody (M03), clone 2F12
| Brand: | Abnova |
| Reference: | H00001406-M03 |
| Product name: | CRX monoclonal antibody (M03), clone 2F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CRX. |
| Clone: | 2F12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1406 |
| Gene name: | CRX |
| Gene alias: | CORD2|CRD|LCA7|OTX3 |
| Gene description: | cone-rod homeobox |
| Genbank accession: | NM_000554 |
| Immunogen: | CRX (NP_000545, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR |
| Protein accession: | NP_000545 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | CRX monoclonal antibody (M03), clone 2F12 Western Blot analysis of CRX expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | OTX2 and CRX rescue overlapping and photoreceptor-specific functions in the Drosophila eye.Terrell D, Xie B, Workman M, Mahato S, Zelhof A, Gebelein B, Cook T. Dev Dyn. 2012 Jan;241(1):215-28. doi: 10.1002/dvdy.22782. Epub 2011 Nov 23. |